Melanocortin receptor is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-12-03. Numbers and descriptions here follow the published literature rather than marketing material.
Published research covers ischemic stroke, traumatic brain injury, cognitive impairment, optic nerve conditions and attention-related measures. Much of the human evidence comes from small trials conducted in one country, which limits how far the results generalize. Animal models supply the larger share of the data, and effects seen in rodents do not transfer automatically to people. Reviews have noted that methodological reporting is often incomplete, making it difficult to pool results or compare treatment schedules across studies.
Pharmacokinetic accounts emphasize rapid breakdown. After intravenous dosing the intact peptide disappears from blood within minutes, and nasal delivery produces low but measurable concentrations. Metabolites rather than the parent molecule may account for part of the observed activity, although the relative contribution is unresolved. Dosing in the literature varies widely and no optimal schedule has been agreed. These gaps are regularly cited as a reason the findings have not produced broad clinical adoption beyond the original research setting.
Proposed mechanisms center on neurotrophic signaling rather than on classical melanocortin receptor activation. Rodent experiments have reported shifts in the expression of brain-derived neurotrophic factor and nerve growth factor after administration, together with changes in the associated receptor systems. Several authors argue that the peptide acts largely through its degradation products and their interaction with peptidergic pathways, but this remains a hypothesis rather than a settled finding. No single molecular target has been identified in a way that the field broadly accepts.
Later generations of the molecule include an N-acetylated form and an amidated form, both marketed online alongside the parent peptide. These variants differ in terminal chemistry and stability, and they are frequently discussed in the same breath even though they have not been compared in controlled trials. Supply outside formal healthcare systems comes largely from laboratories that synthesize peptides to order. Purity and identity of these materials vary widely, and no single body oversees the international trade.
Semax is a synthetic heptapeptide developed in the Soviet Union during the 1980s by researchers at the Institute of Molecular Genetics in Moscow. It was designed as a truncated analog of adrenocorticotropic hormone, retaining only the fragment spanning residues four through ten. Investigators sought a peptide that would preserve the cognitive effects associated with ACTH while eliminating the hormonal stimulation of the adrenal cortex. The compound entered clinical use in Russia during the following decade.
Russian regulatory authorities approved the peptide for nasal administration, and it remains listed in the national pharmacopoeia under several trade names. Documented indications include acute ischemic stroke, transient ischemic attacks, traumatic brain injury, and certain ophthalmological and neurological conditions. Physicians also prescribe it for cognitive complaints in older patients, although the evidence base for that use is thinner. Outside Russia and a few neighboring states, the substance is not an approved medicine and is sold instead as a research chemical.
| Property | Value | Notes |
|---|---|---|
| Primary research models | Rodent studies | Largest share of published data |
| Reported markers | BDNF and NGF expression | Measured mainly in animal tissue |
| Common administration | Intranasal | Matches the registered formulation |
| Blood residence time | Minutes | Rapid enzymatic degradation |
| Evidence quality | Small trials, limited replication | Noted repeatedly in reviews |
Common degradation pathways include oxidation of the methionine side chain, hydrolysis of the peptide backbone, and aggregation under unfavourable pH or concentration. Stability studies typically monitor the main peak by chromatography and report total related substances as a percentage. Because no official monograph exists, acceptance criteria vary between laboratories, and reported purity values are not directly comparable across suppliers. Analysts therefore document the method, column, and detection wavelength alongside each result, and open questions remain about how much biological activity the oxidised forms retain.
Solid semax is typically supplied as a lyophilised powder that is hygroscopic and sensitive to moisture, light, and repeated temperature cycling. Long-term storage of the dry peptide is generally recommended at approximately -20 degrees Celsius, while shorter working periods may use refrigeration at 2 to 8 degrees Celsius. Vials should remain tightly closed and desiccated when brought to room temperature, because condensation can damage the material before it is weighed. Dividing a batch into aliquots is preferable to thawing one container repeatedly.
Scientific literature on semax is unevenly distributed. A substantial share of published work originates from a small number of laboratories in Russia, while independent replication elsewhere is limited. Human data consist mostly of small trials with short follow-up, and several reported outcomes rely on subjective rating scales. Questions about how much intact peptide reaches the central nervous system after nasal administration, and how long it persists there, are still unresolved. The compound is best described as an active research subject rather than a settled pharmacological agent.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It was derived from the ACTH(4-10) fragment, a short segment of adrenocorticotropic hormone that lacks the hormonal activity associated with the full-length peptide. Researchers at the Institute of Molecular Genetics in Moscow developed the compound during the 1980s. It has been registered as a pharmaceutical product in Russia and several neighbouring countries, where it is supplied as a nasal solution, and it is also sold internationally as a research chemical.
The proposed mechanism centres on neurotrophic signalling rather than direct receptor activation. Semax is reported to increase expression of brain-derived neurotrophic factor and nerve growth factor in several brain regions, and to shift the balance between excitatory and inhibitory neurotransmitter systems. Interaction with melanocortin receptors has been suggested because of the parent ACTH fragment. Many of these findings come from rodent studies, and the extent to which they translate to human physiology remains an open question.
Practical handling follows from those properties. Bulk material is best divided into single-use portions soon after receipt, because each thaw exposes the whole container to moisture and temperature cycling. Vials should be allowed to reach room temperature before opening to prevent condensation on the powder. Low-binding plasticware reduces loss of dilute solutions, and sterile filtration is used when a preparation must remain free of microbial growth. Records of batch number, reconstitution date and storage history are what allow a later analytical result to be interpreted meaningfully.
Identity and purity of Semax are established mainly by reversed-phase high-performance liquid chromatography coupled with mass spectrometry. The chromatographic trace gives a purity estimate as a percentage of total peak area, while electrospray or matrix-assisted laser desorption ionization confirms the molecular mass against the calculated value. Amino acid analysis and sequence-specific fragmentation provide further confirmation when a supplier's chain of custody is unclear. Vendors frequently quote a purity figure without stating the detection wavelength or the integration method, which limits how far one number can be compared with another.
Stability depends heavily on physical state. Lyophilized powder held dry, cold and dark retains its content over long periods, whereas dissolved peptide begins to change within days at room temperature. The most cited degradation route is oxidation of the methionine residue, which converts the peptide to a sulfoxide form that elutes differently on chromatography. Hydrolysis of amide bonds and adsorption onto container walls contribute smaller losses. Buffers that exclude oxygen from the headspace slow the oxidation pathway, but no single condition prevents all change indefinitely.
It is for this reason that we have taken the liberty of addressing this communication direct to you." After listing civilian witnesses who could confirm their allegations, Trooper Cochrane concluded, "Sir, many of us are Australians who have fought throughout nearly the whole war while others are Africaners who have fought from Colenso till now. We cannot return home with the stigma of these crimes attached to our names. Therefore we humbly pray that a full and exhaustive inquiry be made by Imperial officers in order that the truth be elicited and justice done. Also we beg that all witnesses may be kept in camp at Pietersburg till the inquiry is finished. So deeply do we deplore the opprobrium which must be inseparably attached to these crimes that scarcely a man once his time is up can be prevailed to re-enlist in this corps. Trusting for the credit of thinking you will grant the inquiry we seek." In response to the letter, Col. Hall summoned all Fort Edward officers to Pietersburg on 21 October. All were met by mounted infantry five miles outside Pietersburg on the morning of 23 October and "brought into town like criminals". Lt. Morant was arrested after returning from leave in Pretoria, where he had gone to settle the affairs of his deceased friend Captain Hunt.
== Structural aspects == Intrinsically disordered proteins adapt a dynamic range of rapidly interchanging conformations in vivo according to the cell's conditions, creating a structural or conformational ensemble. Their structures are strongly function-related. Few proteins are fully disordered in their native state. Disorder is mostly found in intrinsically disordered regions (IDRs) within an otherwise well-structured protein. The term intrinsically disordered protein (IDP) therefore includes proteins that contain IDRs as well as fully disordered proteins. The existence and kind of protein disorder is encoded in its amino acid sequence. In general, IDPs are characterized by a low content of bulky hydrophobic amino acids and a high proportion of polar and charged amino acids, usually referred to as low hydrophobicity. This property leads to good interactions with water. Furthermore, high net charges promote disorder because of electrostatic repulsion resulting from equally charged residues. Thus disordered sequences cannot sufficiently bury a hydrophobic core to fold into stable globular proteins. In some cases, hydrophobic clusters in disordered sequences provide the clues for identifying the regions that undergo coupled folding and binding (refer to biological roles). Many disordered proteins reveal regions without any regular secondary structure. These regions can be termed as flexible, compared to structured loops. While the latter are rigid and contain only one set of Ramachandran angles, IDPs involve multiple sets of angles.
===== North America ===== Canada - DMT is classified as a Schedule III drug under the Controlled Drugs and Substances Act, but is legal for religious groups to use. In 2017 the Santo Daime Church Céu do Montréal received religious exemption to use ayahuasca as a sacrament in their rituals. United States - DMT is classified in the United States as a Schedule I drug under the Controlled Substances Act of 1970. In 2019, it was decriminalized, along with other naturally derived psychedelics, in the city of Oakland after a campaign by Decriminalize Nature.
=== Mammals === Monogamous voles (such as prairie voles) have significantly greater density and distribution of vasopressin receptors in their brain when compared to polygamous voles. These differences are located in the ventral forebrain and the dopamine-mediated reward pathway. Peptide arginine vasopressin (AVP), dopamine, and oxytocin act in this region to coordinate rewarding activities such as mating, and regulate selective affiliation. These species-specific differences have shown to correlate with social behaviors, and in monogamous prairie voles are important for facilitation of pair bonding. When compared to montane voles, which are polygamous, monogamous prairie voles appear to have more of these AVP and oxytocin neurotransmitter receptors. It is important that these receptors are in the reward centers of the brain because that could lead to a conditioned partner preference in the prairie vole compared to the montane vole which would explain why the prairie vole forms pair bonds and the montane vole does not. As noted above, different species of voles vary in their sexual behavior, and these differences correlate with expression levels of vasopressin receptors in reward areas of the brain. Scientists were able to change adult male montane voles' behavior to resemble that of monogamous prairie voles in experiments in which vasopressin receptors were introduced into the brain of male montane voles.
Wolverine continued to appear in a number of series in the 2020s, both as a solo character and as part of multiple teams. During this period, he featured as part of the Savage Avengers (2019–2023), along with Punisher, Elektra, Venom, Brother Voodoo, and Conan the Barbarian. As the "Krakoan Age" continued, Benjamin Percy wrote a new Wolverine ongoing series (vol. 7) beginning in 2020, as well as new X-Force series with Wolverine as leader. In 2022, Percy also wrote a new series titled X Lives of Wolverine and X Deaths of Wolverine, concerning time travel. In Wolverine vol. 7 #50 (May 2024), Logan finally kills Sabretooth. The "Krakoan Age" concluded in 2024. An eighth volume of Wolverine began the same year, written by Saladin Ahmed and illustrated by Martín Cóccolo and Javier Pina.
Sources: en.wikipedia.org
The existence of intermolecular forces was first postulated by Johannes Diderik van der Waals in 1873. However, Nobel laureate Hermann Emil Fischer developed supramolecular chemistry's philosophical roots. In 1894, Fischer suggested that enzyme–substrate interactions take the form of a "lock and key", the fundamental principles of molecular recognition and host–guest chemistry. In the early twentieth century non-covalent bonds were understood in gradually more detail, with the hydrogen bond being described by Latimer and Rodebush in 1920. With the deeper understanding of the non-covalent interactions, for example, the clear elucidation of DNA structure, chemists started to emphasize the importance of non-covalent interactions. In 1967, Charles J. Pedersen discovered crown ethers, which are ring-like structures capable of chelating certain metal ions. Then, in 1969, Jean-Marie Lehn discovered a class of molecules similar to crown ethers, called cryptands. After that, Donald J. Cram synthesized many variations to crown ethers, on top of separate molecules capable of selective interaction with certain chemicals. The three scientists were awarded the Nobel Prize in Chemistry in 1987 for "development and use of molecules with structure-specific interactions of high selectivity". In 2016, Bernard L. Feringa, Sir J. Fraser Stoddart, and Jean-Pierre Sauvage were awarded the Nobel Prize in Chemistry, "for the design and synthesis of molecular machines".
Because Psilocybe cubensis is intimately associated with cattle ranching, the fungus has found unique dispersal niches not available to most other members of the family Hymenogastraceae. Of particular interest is the cattle egret (Bubulcus ibis), a colonizer of Old World origin (via South America), whose range of distribution overlaps much of that of Psilocybe cubensis. Cattle egrets typically walk alongside cattle, preying on insects; they track through spore-laden vegetation and cow dung and transfer the spores to suitable habitats, often thousands of miles away during migration activities. This type of spore dispersal is known as zoochory, and it enables a parent species to propagate over a much greater range than it could achieve alone. The relationship between cattle, cattle egrets, and Psilocybe cubensis is an example of symbiosis—a situation in which dissimilar organisms live together in close association.
Todd Lynn Helton (born August 20, 1973) is an American former professional baseball first baseman who played his entire 17-year Major League Baseball (MLB) career for the Colorado Rockies. A five-time All-Star, four-time Silver Slugger, and three-time Gold Glove Award winner, Helton holds the Rockies' club records for hits (2,519), home runs (369), doubles (592), walks (1,335), runs scored (1,401), runs batted in (RBIs, with 1,406), games played (2,247), and total bases (4,292), among others. Helton grew up in Tennessee and played college baseball and football for the Tennessee Volunteers. The Rockies drafted him in the first round of the 1995 MLB draft, and he debuted in the majors in 1997. During his peak from 1999 to 2004, Helton met or topped these benchmarks each season: .320 batting average, 39 doubles, 30 home runs, 107 runs scored, 96 RBI, .577 slugging percentage and .981 on-base plus slugging. In 2000, he won the batting title with a .372 average and also led MLB with a .698 slugging percentage, 59 doubles, and 147 RBI and the National League (NL) with 216 hits. Helton helped the Rockies win the NL pennant in 2007 before being swept in the World Series. He collected his 2,000th career hit in May 19, 2009 and his 2,500th on September 1, 2013. He retired at the end of that season, homering in his final game at Coors Field. Helton was inducted into the Baseball Hall of Fame in 2024, his sixth year on the ballot.
As the Kulturkampf declined, debates about the character of the party emerged culminating in the Centre dispute, in 1906, after Julius Bachem had published the article "We must get out of the tower!" He called upon Catholic politicians to fulfill Windthorst's word and get out of their perpetual minority position by an effort to increase Protestant numbers among their representatives in parliament. His proposal was met with passionate opposition by the greater part of Catholic public, especially since it also included the Christian trade unions and other Catholic organisations. No side could win the upper hand, when the outbreak of World War I ended the dispute. After the war, there were many proposals on how the reform the party. Heinrich Brauns published the Cologne Program (Kölner Programm), which proposed the re-formation of the Zentrum under a new name (Christliche Volkspartei, CVP). This proposal was rejected, with only a few regions adopting it for the 1919 election; the party instead adopted the Berlin Guidelines (Berliner Leitsätze), which were more moderate but failed at making the Zentrum attractive for Protestant voters too. Adam Stegerwald, leader of the Christian trade unions, made another attempt at transcending the party's exclusively Catholic character and uniting Germany's fragmented party spectrum. In 1920 he advocated the formation of a broad Christian middle-party, that would transcend denominations and social classes and which could push back the Social Democrats' influence.
=== Mortality === CRE resistance depends upon a number of factors such as the health of the patient, whether the patient has recently undergone a transplant, risk of co-infection, and use of multiple antibiotics. Carbapenem minimal inhibitory concentrations (MICs) results may be more predictive of clinical patient outcomes than the current categorical classification of the MICs being listed as susceptible, intermediate, or resistant. The study aimed to define an all-cause hospital mortality breakpoint for carbapenem MICs that were adjusted for risk factors. Another objective was to determine if a similar breakpoint existed for indirect outcomes, such as the time to death and length of stay after infection for survivors. Seventy-one patients were included, of which 52 patients survived and 19 patients died. Classification and regression tree analysis determined a split of organism MIC between 2 and 4 mg/liter and predicted differences in mortality (16.1% for 2 mg/liter versus 76.9% for 4 mg/liter). In logistic regression controlling for confounders, each imipenem MIC doubling dilution doubled the probability of death. This classification scheme correctly predicted 82.6% of cases. Patients were accordingly stratified to MICs of ≤2 mg/liter (58 patients) and ≥4 mg/liter (13 patients). Patients in the group with a MIC of ≥4 mg/liter tended to be more ill. Secondary outcomes were also similar between groups. Patients with organisms that had an MIC of ≥4 mg/liter had worse outcomes than those with isolates of an MIC of ≤2 mg/liter.
Sources: en.wikipedia.org
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
=== Pharmacokinetics === Metabolism of ciprofol occurs primarily in the liver through oxidation, glucuronidation, and sulfation, resulting in the formation of the inactive metabolite M4-glucuronide, which is excreted renally. It is not necessary to adjust the dose in people with mild or moderate renal impairment, or in those with mild or moderate hepatic impairment. In elderly people, a slightly lower dose (0.3 mg/kg) appears to be similar in efficacy to the higher doses administered to younger people but is associated with fewer adverse effects. Ciprofol has a short elimination half-life, generally between 2 and 4 hours. Owing to its rapid metabolism and high clearance, the drug does not tend to accumulate in the body, even during prolonged infusions.
== History == Oxytocin's uterine-contracting properties were discovered by British pharmacologist Henry Hallett Dale in 1906. Oxytocin's milk ejection property was described by Ott and Scott in 1910 and by Schafer and Mackenzie in 1911. Oxytocin was the first polypeptide hormone to be sequenced or synthesized. Du Vigneaud was awarded the Nobel Prize in 1955 for his work.
internal ribosome entry site (IRES) A sequence present in some messenger RNAs that permits recognition by the ribosome and thus the initiation of translation even in the absence of a 5' cap, which in eukaryotes is otherwise required for assembly of the initiation complex. IRES elements are often located in the 5' untranslated region, but may also be found in other positions.
=== Film === The rotoscoped film A Scanner Darkly was authorized by Dick's estate. It was released in July 2006 and stars Keanu Reeves as Fred/Bob Arctor and Winona Ryder as Donna. Rory Cochrane, Robert Downey Jr., and Woody Harrelson co-star as Arctor's drugged-out housemates and friends. The film was directed by Richard Linklater.
Sources: en.wikipedia.org
The main proposal is modulation of neurotrophic factors such as brain-derived neurotrophic factor, supported largely by animal experiments. Receptor-level targets have not been firmly established. Most reviews describe the mechanism as only partially characterized.
The compound is registered as a medicine in Russia, so clinical work has concentrated there. Trials elsewhere are few and generally small. This geographic concentration is a recognized limitation in evidence reviews.
Some fraction may reach the central nervous system through olfactory pathways, and this is often cited as the rationale for the nasal route. The size of that fraction in humans is not well quantified. Blood concentrations after nasal dosing are low, which complicates measurement.
It originated at the Institute of Molecular Genetics in Moscow during the 1980s. The work was carried out by a Russian research group that specialized in peptide neuropharmacology.